PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01515.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31495.4 Da    PI: 6.2698
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01515.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.2e-18125179256
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Sme2.5_01515.1_g00005.1 125 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 179
                              788899***********************************************98 PP

2HD-ZIP_I/II1284.1e-41125214191
              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 
                              +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+e
  Sme2.5_01515.1_g00005.1 125 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKEVSE 210
                              69************************************************************************************ PP

              HD-ZIP_I/II  87 Lreel 91 
                              Lr +l
  Sme2.5_01515.1_g00005.1 211 LR-AL 214
                              *9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.3E-133101IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.97E-18120182IPR009057Homeodomain-like
PROSITE profilePS5007117.281121181IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-18121184IPR009057Homeodomain-like
SMARTSM003892.1E-15123185IPR001356Homeobox domain
CDDcd000862.44E-15125182No hitNo description
PfamPF000463.7E-16125179IPR001356Homeobox domain
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
SMARTSM003402.8E-26181224IPR003106Leucine zipper, homeobox-associated
PfamPF021836.5E-11181215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSGEKEDGLG LSLSLGIMSS PQKTLKNDFT LNLLPFMNHH QISSGRKDEE GERVRGDIDM  60
NEPARMILEC DNVEEEEEED QVIMVSSPNS TVSSVSGKRS HEREENEGER ATSSLEDDGG  120
DAAARKKLRL SKEQAAVLEE TFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL  180
KQTEVDCEYL KRCCETLTEE NRRLQKEVSE LRALKLSPQL YMNMSPPTTL TMCPQCERVA  240
VSSSSSSAVS SSVTGASASR SHHQAPVPLN KSWAAILAPK TL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136130.0BT013613.1 Lycopersicon esculentum clone 132414F, mRNA sequence.
GenBankX912120.0X91212.1 L.esculentum mRNA for HD-ZIP protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234233.11e-158HD-ZIP protein
RefseqXP_015065330.11e-159PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP929532e-83ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLQ424371e-158Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-62homeobox-leucine zipper protein 3